PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr030882.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 574aa    MW: 64374.7 Da    PI: 4.5475
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr030882.2genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.11.2e-51181442128
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                  +pGfrFhPtdeelv +yLk+k+ +k+l++ +vi+e+d+yk++P++Lp+   +k+++++w+fFs+rd+ky++g r++rat++gyWkatgkd+++++  +
  Pbr030882.2  18 APGFRFHPTDEELVLYYLKRKICKKRLKI-DVIAETDVYKWDPEELPElsLLKTGDRQWFFFSPRDRKYPNGGRSSRATRHGYWKATGKDRNIVC-YS 113
                  69***************************.99**************9445788899***************************************.99 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  + vglkktLv+ykgrap+ge+tdWvmhey++
  Pbr030882.2 114 RSVGLKKTLVYYKGRAPSGERTDWVMHEYTM 144
                  99***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-5714167IPR003441NAC domain
PROSITE profilePS5100553.60717167IPR003441NAC domain
PfamPF023651.0E-2619143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 574 aa     Download sequence    Send to blast
MVTEDDPAAL FCDGHFAAPG FRFHPTDEEL VLYYLKRKIC KKRLKIDVIA ETDVYKWDPE  60
ELPELSLLKT GDRQWFFFSP RDRKYPNGGR SSRATRHGYW KATGKDRNIV CYSRSVGLKK  120
TLVYYKGRAP SGERTDWVMH EYTMDEEELK RCQNVQQYYA LYKVYKKSGP GPKNGEQYGA  180
PFREEDWVDD ESPVIKTSAD CQISVKEAVD VVSIDNVKGN GEVHYAPDDI EEFMKQMADE  240
AVLPQMNGYG YTAPQVVSEE DTQSGLVDLY SREVFSPELI KEFNPNVQQC YVKANFDFTQ  300
SATSQMQLHE ASEVTTAVPD IYEHGPPVLH EEDFLEMDDL LGPEPTVPNT LNPVDDLQFG  360
ELDGLSEFEL YHDAAMFLHD LGPVDEGNVS HHQYMNSQGN NIVDQFEYHL QPNPAAENQV  420
NHVLNPELAQ MNNQLWTNTE GAEPIQGSLS YSTSGVVNES SNFPSRATQN QNGNEAAGAT  480
SQFSSALWAF VESIPTTPAS ASESALVNRA FERMSSFSRL RINTASTTAG NGSETMRAGI  540
KRGFFFLPVL VALCAIFWIL MATLRPPGRC LPA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-481914417140Stress-induced transcription factor NAC1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13544KRKICKKRLK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00179DAPTransfer from AT1G34190Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009339761.10.0PREDICTED: uncharacterized protein LOC103931956
TrEMBLM5W6F50.0M5W6F5_PRUPE; Uncharacterized protein
STRINGPOPTR_0002s06210.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61313451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-155NAC domain containing protein 17